Signup for Free Email       Login to your Email

Dork.org

What a dork!
We don't know what to do with this domain name, Dork.org...
Until We figure out what to do, We offer free email account (your-name @ dork.org) :-)
It is powered by Gmail.com. So, you know it's good. However...
Be quick about it since acct # is limited. Click here to Signup for Free Email.

New! Search: Web pages   Auctions   Books   Music   Electronics   E-products  

4,210,000 Results - search results



Related results

Real Estate Advisor | Search Results
real estate advisor one ... in Denton, TX returned 123 results. Only 10 listings will display per ... 210,000 / 4 BR / Pic (>60 days) [ Century 21 ] / Save ...
http://www.realestateadvisor.com/TX/DENTON/Denton/

Art's-Way Third Quarter and 9 Month Results - Oct. 16, 2006
... and 9 Month Results. October 16, 2006: 4:24 p.m. EST ... order backlog increased to $4,210,000 compared to $2,629,000 a year ago, Art's-Way Vessels, Inc. ...
http://money.cnn.com/news/newsfeeds/articles/prnewswire/200610161624PR_NEWS_USPR_____CGM062.htm

Diedrich Coffee Reports Third Quarter Results
... net income from Discontinued Operations of $4,210,000, or $0.77 per share. ... to-date, results from Continuing Operations were a loss of $4,349,000, or $0.80 ...
http://www.prnewswire.com/cgi-bin/stories.pl?ACCT=104&STORY=/www/story/04-21-2008/0004797126&EDATE=

Real Estate Listings for Acreages and Homes in Northwest Iowa from ...
Northwest iowa real estate, iowa real estate, property for sales, ... Home ι contact. Auctions ι Real Estate ι Communities ι land sale results. Check Back Often ...
http://www.klaassenrealty.com/northwest_iowa_listings.htm

1,210,000,000 results - Search Results - MSN Encarta
Ah now .com Results 1 - 10 of about 1,210,000,000. Google Yahoo Adobe Adobe ... employees telstra" has no results ... 1,210,000,000 for "happy" "happy children" ...
http://encarta.msn.com/encnet/refpages/search.aspx?q=1,210,000,000+results

2,210,000 results - Search Results - MSN Encarta
See all search results in Maps (61) Books about "2,210,000 results" ... 2,210,000,000 Relevant Search Results For Contact Center Services — Further ...
http://encarta.msn.com/encnet/refpages/search.aspx?q=2,210,000+results

CLOSURE Medical Corporation Reports Third Quarter Results
... were $2,732,000 compared to $4,210,000, including product development revenues ... development revenues -- 1,500 -- 1,500 Total revenues 2,732 4,210 10,826 ...
http://www.prnewswire.com/cgi-bin/stories.pl?ACCT=105&STORY=/www/story/10-21-1999/0001050445

Belize Real Estate , Belize properties, Belize island properties, land ...
Your search returned no results. Please try a less specific search. Search Listings ... 50.12 Acres Creek Side Property - Lil Vaqueros Creek and Privassion Creek ...
http://www.belizejewelrealtors.com/index.php?action=searchresults&district=Orange+Walk&sorttype=ASC

www.pdg.cnb.uam.es/cafasp3ContactsEvaluation/T0152_pdgcon.txt
Contact prediction server results. # # > T0152 210 bp MTKPTSAGQADDALVRLARERFDLPDQVRRLARPPVPSLEPPYGLRVAQLTDAEMLAEWM ... 000 4 206 0 8 1.000 4 209 0 8 1.000 4 ...
http://www.pdg.cnb.uam.es/cafasp3ContactsEvaluation/T0152_pdgcon.txt

CardPlayer.com - Player Database - Results for Shane Schleger
Live Updates for Shane Schleger ... Seat 1 - Kevin "BeLOWaBOVe" Saul - $4,210,000. Seat 2 - Eracles "Eric" Panayioyou - $759,000 ...
http://www.cardplayer.com/players/live_updates/10277?event_day_id=12120

Sponsored links:


dork
1. a stupid or ridiculous person; jerk; nerd.
2. Vulgar.
[Origin: 1960–65; expressive coinage; cf. similar phonetic elements in dolt, dong3, jerk1, etc.]

dork
1. Slang. A stupid, inept, or foolish person: "The stupid antics of America's favorite teen-age cartoon dorks” (Joshua Mooney).
2. Vulgar Slang.

dork
n : a dull stupid fatuous person [syn: jerk]